Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Sensor histidine kinase desK (desK)

This Recombinant Bacillus subtilis Sensor histidine kinase desK (desK) spans the amino acid sequence from region 1-370.

Product Specifications

Product Name Alternative

Sensor histidine kinase desK, EC= 2.7.13.3

UniProt

O34757

Expression Region

1-370

Origin

Bacillus subtilis (strain 168)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKNHFTFQKLNGITPYIWTIFFILPFYFIWKSSSTFVIIVGIILTLLFFSVYRFAFVSK GWTIYLWGFLLIGISTASITLFSYIYFAFFIAYFIGNIKERVPFHILYYVHLISAAVAAN FSLVLKKEFFLTQIPFVVITLISAILLPFSIKSRKERERLEEKLEDANERIAELVKLEER QRIARDLHDTLGQKLSLIGLKSDLARKLIYKDPEQAARELKSVQQTARTSLNEVRKIVSS MKGIRLKDELINIKQILEAADIMFIYEEEKWPENISLLNENILSMCLKEAVTNVVKHSQA KTCRVDIQQLWKEVVITVSDDGTFKGEENSFSKGHGLLGMRERLEFANGSLHIDTENGTK LTMAIPNNSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C8orf45 Polyclonal Antibody
orb1419706 100 µL

C8orf45 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal IL-15 Antibody Pair [HRP]
NBP2-79584-15Plates 15 Plates

Rabbit Monoclonal IL-15 Antibody Pair [HRP]

Sign In for Pricing
View Details
Canine Ankyrin B ELISA Kit
MBS008141-01 48 Well

Canine Ankyrin B ELISA Kit

Sign In for Pricing
View Details
Canine Ankyrin B ELISA Kit
MBS008141-02 96 Well

Canine Ankyrin B ELISA Kit

Sign In for Pricing
View Details
Canine Ankyrin B ELISA Kit
MBS008141-03 5x 96 Well

Canine Ankyrin B ELISA Kit

Sign In for Pricing
View Details
Canine Ankyrin B ELISA Kit
MBS008141-04 10x 96 Well

Canine Ankyrin B ELISA Kit

Sign In for Pricing
View Details