Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lysosomal-associated transmembrane protein 4B (LAPTM4B)

This Recombinant Human Lysosomal-associated transmembrane protein 4B (LAPTM4B) spans the amino acid sequence from region 1-370.

Product Specifications

Product Name Alternative

Lysosomal-associated transmembrane protein 4B, Lysosome-associated transmembrane protein 4-beta

UniProt

Q86VI4

Expression Region

1-370

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELHERPDERRKARTSTQGRLGDWRRVHADGFTHRVLGAPAAAWSSSSWLEPAMTSRTRV TWPSPPRPLPVPAAAAVAFGAKGTDPAEARSSRGIEEAGPRAHGRAGREPERRRSRQQRR GGLQARRSTLLKTCARARATAPGAMKMVAPWTRFYSNSCCLCCHVRTGTILLGVWYLIIN AVVLLILLSALADPDQYNFSSSELGGDFEFMDDANMCIAIAISLLMILICAMATYGAYKQ RAAWIIPFFCYQIFDFALNMLVAITVLIYPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVL IILLFISIILTFKGYLISCVWNCYRYINGRNSSDVLVYVTSNDTTVLLPPYDDATVNGAA KEPPPPYVSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab4 (RAB4A) Mouse Monoclonal Antibody [Clone ID: 4E11]
AM06774PU-N 100 µg

Rab4 (RAB4A) Mouse Monoclonal Antibody [Clone ID: 4E11]

Sign In for Pricing
View Details
Gadoteric Acid
TRC-G125855-50MG 50 mg

Gadoteric Acid

Sign In for Pricing
View Details
Biotin Anti-Human CD8a Antibody[OKT-8]
E-AB-F1110B-01 25 µg

Biotin Anti-Human CD8a Antibody[OKT-8]

Sign In for Pricing
View Details
Biotin Anti-Human CD8a Antibody[OKT-8]
E-AB-F1110B-02 100 µg

Biotin Anti-Human CD8a Antibody[OKT-8]

Sign In for Pricing
View Details
Frozen Tissue Sections, Liver
CS622229 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
Human PPP1R3G activation kit by CRISPRa
GA118809 1 Kit

Human PPP1R3G activation kit by CRISPRa

Sign In for Pricing
View Details