Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lysosomal-associated transmembrane protein 4B (LAPTM4B)

This Recombinant Human Lysosomal-associated transmembrane protein 4B (LAPTM4B) spans the amino acid sequence from region 1-370.

Product Specifications

Product Name Alternative

Lysosomal-associated transmembrane protein 4B, Lysosome-associated transmembrane protein 4-beta

UniProt

Q86VI4

Expression Region

1-370

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELHERPDERRKARTSTQGRLGDWRRVHADGFTHRVLGAPAAAWSSSSWLEPAMTSRTRV TWPSPPRPLPVPAAAAVAFGAKGTDPAEARSSRGIEEAGPRAHGRAGREPERRRSRQQRR GGLQARRSTLLKTCARARATAPGAMKMVAPWTRFYSNSCCLCCHVRTGTILLGVWYLIIN AVVLLILLSALADPDQYNFSSSELGGDFEFMDDANMCIAIAISLLMILICAMATYGAYKQ RAAWIIPFFCYQIFDFALNMLVAITVLIYPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVL IILLFISIILTFKGYLISCVWNCYRYINGRNSSDVLVYVTSNDTTVLLPPYDDATVNGAA KEPPPPYVSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTEN Polyclonal Antibody
E-AB-63495-01 60 µL

PTEN Polyclonal Antibody

Sign In for Pricing
View Details
PTEN Polyclonal Antibody
E-AB-63495-02 120 µL

PTEN Polyclonal Antibody

Sign In for Pricing
View Details
PTEN Polyclonal Antibody
E-AB-63495-03 200 µL

PTEN Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human GRP78 protein (His tag)
PDEH100838-01 20 µg

Recombinant Human GRP78 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human GRP78 protein (His tag)
PDEH100838-02 100 µg

Recombinant Human GRP78 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human GRP78 protein (His tag)
PDEH100838-03 500 µg

Recombinant Human GRP78 protein (His tag)

Sign In for Pricing
View Details