Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gap junction delta-4 protein (GJD4)

This Recombinant Human Gap junction delta-4 protein (GJD4) spans the amino acid sequence from region 1-370.

Product Specifications

Product Name Alternative

Gap junction delta-4 protein, Connexin-40.1, Cx40.1

UniProt

Q96KN9

Expression Region

1-370

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGVDLLGFLIITLNCNVTMVGKLWFVLTMLLRMLVIVLAGRPVYQDEQERFVCNTLQPG CANVCYDVFSPVSHLRFWLIQGVCVLLPSAVFSVYVLHRGATLAALGPRRCPDPREPASG QRRCPRPFGERGGLQVPDFSAGYIIHLLLRTLLEAAFGALHYFLFGFLAPKKFPCTRPPC TGVVDCYVSRPTEKSLLMLFLWAVSALSFLLGLADLVCSLRRRMRRRPGPPTSPSIRKQS GASGHAEGRRTDEEGGREEEGAPAPPGARAGGEGAGSPRRTSRVSGHTKIPDEDESEVTS SASEKLGRQPRGRPHREAAQDPRGSGSEEQPSAAPSRLAAPPSCSSLQPPDPPASSSGAP HLRARKSEWV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dead End Protein Homolog 1 (DND1) Antibody
abx340719-01 20 µL

Dead End Protein Homolog 1 (DND1) Antibody

Sign In for Pricing
View Details
Dead End Protein Homolog 1 (DND1) Antibody
abx340719-02 50 µL

Dead End Protein Homolog 1 (DND1) Antibody

Sign In for Pricing
View Details
Dead End Protein Homolog 1 (DND1) Antibody
abx340719-03 100 µL

Dead End Protein Homolog 1 (DND1) Antibody

Sign In for Pricing
View Details
Dead End Protein Homolog 1 (DND1) Antibody
abx340719-04 200 µL

Dead End Protein Homolog 1 (DND1) Antibody

Sign In for Pricing
View Details
Dead End Protein Homolog 1 (DND1) Antibody
abx340719-05 1 mL

Dead End Protein Homolog 1 (DND1) Antibody

Sign In for Pricing
View Details
Mouse Neuroglobin ELISA Kit
ELA-E0606m 96 Tests

Mouse Neuroglobin ELISA Kit

Sign In for Pricing
View Details