Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein AdrA (adrA)

This Recombinant Protein AdrA (adrA) spans the amino acid sequence from region 1-371.

Product Specifications

Product Name Alternative

Protein AdrA

UniProt

P0AAP2

Expression Region

1-371

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFPKIMNDENFFKKAAAHGEEPPLTPQNEHQRSGLRFARRVRLPRAVGLAGMFLPIASTL VSHPPPGWWWLVLVGWAFVWPHLAWQIASRAVDPLSREIYNLKTDAVLAGMWVGVMGVNV LPSTAMLMIMCLNLMGAGGPRLFVAGLVLMVVSCLVTLELTGITVSFNSAPLEWWLSLPI IVIYPLLFGWVSYQTATKLAEHKRRLQVMSTRDGMTGVYNRRHWETMLRNEFDNCRRHNR DATLLIIDIDHFKSINDTWGHDVGDEAIVALTRQLQITLRGSDVIGRFGGDEFAVIMSGT PAESAITAMLRVHEGLNTLRLPNTPQVTLRISVGVAPLNPQMSHYREWLKSADLALYKAK KAGRNRTEVAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VRK2 (NM_001130481) Human Over-expression Lysate
LC427219 20 µg

VRK2 (NM_001130481) Human Over-expression Lysate

Sign In for Pricing
View Details
Human TATA Box Binding Protein Associated Factor 13 (TAF13) ELISA Kit
RD-TAF13-Hu-01 96 Tests

Human TATA Box Binding Protein Associated Factor 13 (TAF13) ELISA Kit

Sign In for Pricing
View Details
Human TATA Box Binding Protein Associated Factor 13 (TAF13) ELISA Kit
RD-TAF13-Hu-02 48 Tests

Human TATA Box Binding Protein Associated Factor 13 (TAF13) ELISA Kit

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-13/IL-13 Protein (His Tag)
PKSM041072-01 10 µg

Recombinant Mouse Interleukin-13/IL-13 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-13/IL-13 Protein (His Tag)
PKSM041072-02 50 µg

Recombinant Mouse Interleukin-13/IL-13 Protein (His Tag)

Sign In for Pricing
View Details
Human CXADR/CAR, C-His Tag
HA211206-01 20 µg

Human CXADR/CAR, C-His Tag

Sign In for Pricing
View Details