Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Debaryomyces hansenii Palmitoyltransferase ERF2 (ERF2)

This Recombinant Debaryomyces hansenii Palmitoyltransferase ERF2 (ERF2) spans the amino acid sequence from region 1-371.

Product Specifications

Product Name Alternative

Palmitoyltransferase ERF2, EC= 2.3.1.-, DHHC cysteine-rich domain-containing protein ERF2, Ras protein acyltransferase

UniProt

Q6BHT4

Expression Region

1-371

Origin

Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSRRERYSVEPIPNDANEFQDNVSFIHKFITNWLITDPSLRNPGSEKNVKAKNYQVQKHE NVQFIYLCGGRLRSVKQKPINVVTGISILIPGILFWIFEAKWIWFHVNPSIVILFSYFWL ITVSFFIKASMSDPGMLPRNIHVPYSISNANTSPKASPPDEYFNIISLPYNAEDHTGVGL KYCATCHIWRSPRASHCSVCNSCIISHDHHCVFLNNCIGYRNYKYFLWFLLFAVLGCILM SVISFIHVFYYRLGMETSVSTFRSSISKYPVSFLLCIYSLLALVYPFPLLIFHIFLTSYN LTTREYFNNVRGVKNSQNHFTNHFDTHSIFKNLYINWLGRARGFSLVRQTDSYQIGDLRF EKLDPLQSFSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL
BNC470178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF740 conjugate, 0.1mg/mL
BNC740151-500 1x 500 µL

CD11a (Cris-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL
BNC740003-500 1x 500 µL

CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF740 conjugate, 0.1mg/mL
BNC741035-500 1x 500 µL

CD8 (C8/1035), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL
BNC400276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL
BNC880034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details