Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Innexin-16 (inx-16)

This Recombinant Innexin-16 (inx-16) spans the amino acid sequence from region 1-372.

Product Specifications

Product Name Alternative

Innexin-16, Protein opu-16

UniProt

O61787

Expression Region

1-372

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSMLGNIKTYAQTVTSLSDNDDTSIDRLNYVVTTSILIAFSLLLFAKNYVGEPMQCWTPN QFAGGWESFAESYCFIENTYFVPMQDSNLPAAETREGREMIYYQWVPFLLVIQALFFCVP RAFWIIYPSYSGLTIADMITAARQNGKQLEGADEALEQVAMINWRTEQQKGHGSRIFNCY LVMKLLILLNIVLQFFLLNSFLNTAYTFWGWGIFWDMVNGRHWQESGHFPRVSFCDINVR ELGNIHHWSLQCVLMVNMFNEKIFIFLWFWFAFLLVATAGDFVIWVWRRFDSNSKLGFIL DLLNQEGIDHSPQKASELYKNVLRDDGVLFLRLLDSNSGRLNSEELMKKIYNISVGHATD LNTPIEEHATSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Histone H4 [ac Lys5 ac Lys8 ac Lys12] Antibody
NBP2-59252 50 µg

Rabbit Polyclonal Histone H4 [ac Lys5 ac Lys8 ac Lys12] Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal SMC1 [p Ser957] Antibody [CoraFluor 1]
NB100-205CL1 0.1 mL

Rabbit Polyclonal SMC1 [p Ser957] Antibody [CoraFluor 1]

Sign In for Pricing
View Details
MIRacle™ hsa-miR-4482-3p miRNA Agomir/Antagomir
AM0115 2 OD, 4 OD, 50 OD

MIRacle™ hsa-miR-4482-3p miRNA Agomir/Antagomir

Sign In for Pricing
View Details
EPS8L2 Polyclonal Antibody
A67958-020 20 µL

EPS8L2 Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Tmed8 shRNA (UAS) - Lentiviral mouse Tmed8 shRNA (UAS, GFP) (100)
GTR15236397 1 Vial

Lentiviral mouse Tmed8 shRNA (UAS) - Lentiviral mouse Tmed8 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Apaf-ALT Polyclonal Antibody
40600-01 50 µL

Apaf-ALT Polyclonal Antibody

Sign In for Pricing
View Details