Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fatty acid 2-hydroxylase (FA2H)

This Recombinant Human Fatty acid 2-hydroxylase (FA2H) spans the amino acid sequence from region 1-372.

Product Specifications

Product Name Alternative

Fatty acid 2-hydroxylase, EC= 1.-.-.-, Fatty acid alpha-hydroxylase

UniProt

Q7L5A8

Expression Region

1-372

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISA DLDGPPHRHSANARRWLEQYYVGELRGEQQGSMENEPVALEETQKTDPAMEPRFKVVDWD KDLVDWRKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGLSKTVWYSVPIIWVPLV LYLSWSYYRTFAQGNVRLFTSFTTEYTVAVPKSMFPGLFMLGTFLWSLIEYLIHRFLFHM KPPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCMQLILPEAVGGTV FAGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKAHHVKHHFAHQKSGFGISTKLWDYCFH TLTPEKPHLKTQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant GSK3 alpha Antibody
RC-5012-01 50 μL

Recombinant GSK3 alpha Antibody

Sign In for Pricing
View Details
Recombinant GSK3 alpha Antibody
RC-5012-02 100 µL

Recombinant GSK3 alpha Antibody

Sign In for Pricing
View Details
Recombinant GSK3 alpha Antibody
RC-5012-03 1 mL

Recombinant GSK3 alpha Antibody

Sign In for Pricing
View Details
SUMO-1 (SM1/495), CF740 conjugate, 0.1mg/mL
BNC740495-100 1x 100 µL

SUMO-1 (SM1/495), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sprouty 2 (SPRY2) (NM_005842) Human Over-expression Lysate
LY401772 100 µg

Sprouty 2 (SPRY2) (NM_005842) Human Over-expression Lysate

Sign In for Pricing
View Details
LRGUK Antibody
KC-28939-01 50 μL

LRGUK Antibody

Sign In for Pricing
View Details