Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fatty acid 2-hydroxylase (FA2H)

This Recombinant Human Fatty acid 2-hydroxylase (FA2H) spans the amino acid sequence from region 1-372.

Product Specifications

Product Name Alternative

Fatty acid 2-hydroxylase, EC= 1.-.-.-, Fatty acid alpha-hydroxylase

UniProt

Q7L5A8

Expression Region

1-372

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISA DLDGPPHRHSANARRWLEQYYVGELRGEQQGSMENEPVALEETQKTDPAMEPRFKVVDWD KDLVDWRKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGLSKTVWYSVPIIWVPLV LYLSWSYYRTFAQGNVRLFTSFTTEYTVAVPKSMFPGLFMLGTFLWSLIEYLIHRFLFHM KPPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCMQLILPEAVGGTV FAGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKAHHVKHHFAHQKSGFGISTKLWDYCFH TLTPEKPHLKTQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CF®594 TUNEL Assay Apoptosis Detection Kit
#30064 1 Kit

CF®594 TUNEL Assay Apoptosis Detection Kit

Sign In for Pricing
View Details
MAD2 (MAD2L1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4D2]
TA500617BM 100 µL

MAD2 (MAD2L1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4D2]

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor) (GFR/2341), CF488A conjugate, 0.1mg/mL
BNC882341-100 1x 100 µL

EGFR (Epidermal Growth Factor Receptor) (GFR/2341), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ATP Synthase (Mitochondrial Complex V) Microplate Assay Kit
RDSM124 100 Assays

ATP Synthase (Mitochondrial Complex V) Microplate Assay Kit

Sign In for Pricing
View Details
UBIAD1 Rabbit Polyclonal Antibody
TA368074 100 µL

UBIAD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-9E3), CF594 conjugate, 0.1mg/mL
BNC940010-100 1x 100 µL

MART-1 / Melan-A (M2-9E3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details