Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Fatty acid 2-hydroxylase (Fa2h)

This Recombinant Mouse Fatty acid 2-hydroxylase (Fa2h) spans the amino acid sequence from region 1-372.

Product Specifications

Product Name Alternative

Fatty acid 2-hydroxylase, EC= 1.-.-.-, Fatty acid alpha-hydroxylase

UniProt

Q5MPP0

Expression Region

1-372

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPAPPPAASFTPAEVQRRLAAGACWVRRGASLYDLTSFVRHHPGGEQLLLARAGQDISA DLDGPPHRHSDNARRWLEQYYVGELRADPQDPTENGAVASAETQKTDPALEPQFKVVDWD KDLVDWQKPLLWQVGHLGEKYDEWVHQPVARPIRLFHSDLIEAFSKTVWYSVPIIWVPLV LYLSWSYYRTLTQDNIRLFASLTREYSMMMPESVFIGLFVLGMLFWTFVEYVIHRFLFHM KPPSNSHYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIAFFYVFLRLILPETVGGII FAGGLLGYVLYDMTHYYLHFGSPHKGSYLYNMKAHHVKHHFEYQKSGFGISTKLWDYFFH TLIPEEAHPKMQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH1A1 Human Gene Knockout Kit (CRISPR)
KN200723 1 Kit

ALDH1A1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ERCC6L activation kit by CRISPRa
GA110286 1 Kit

Human ERCC6L activation kit by CRISPRa

Sign In for Pricing
View Details
FITC (Fluorescein isothiocyanate) Avidin Kit
BAK-001 5 mg

FITC (Fluorescein isothiocyanate) Avidin Kit

Sign In for Pricing
View Details
Tcp11l2 Mouse Gene Knockout Kit (CRISPR)
KN517350 1 Kit

Tcp11l2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Slc18a2 (496-515) Rabbit Polyclonal Antibody
20042 100 µL

Slc18a2 (496-515) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant RAD50 Antibody
RC-5891-01 50 μL

Recombinant RAD50 Antibody

Sign In for Pricing
View Details