Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anopheles gambiae Innexin shaking-B (shakB)

This Recombinant Anopheles gambiae Innexin shaking-B (shakB) spans the amino acid sequence from region 1-373.

Product Specifications

Product Name Alternative

Innexin shaking-B

UniProt

Q7PXN1

Expression Region

1-373

Origin

Anopheles gambiae (African malaria mosquito)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLDIFRGLKSLVKISHVNTDSPVFRLHYSITVIILMSFSLIVTTRQYVGNPIDCVHTKDI PADVLNTYCWIHSTFALKSLFLKEVGKDVPYPGVGNSAEATAADKKIYKYYQWVCFCLFF QAILFYTPRWLWKSWEGGKIHALMMDLDIGICSEIEKKQKKKLLLDYLWDNLRYHNWWAY RYYVCEFLSLCNVIGQMFLMNRFFDGEFMTFGLDVITHMEADQEDRMDPMIYIFPRMTKC TFYKYGVSGEVERHDAICILPLNVVNEKIYIFLWFWFIILTILTTLTIFYRIIIIFSPRM RVYLLRLRFRLVRRDAIEIIVRRSKMGDWFLLYRLGENLDSIIFRDVMQDLANRLHNNQH HRVPGMKGEIQDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL
BNC680029-100 1x 100 µL

Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL
BNC470266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL
BNC400181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL
BNC940040-100 1x 100 µL

CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Mantle Cell Lymphoma Marker) (CD5/2416), CF568 conjugate, 0.1mg/mL
BNC682416-500 1x 500 µL

CD5 (Mantle Cell Lymphoma Marker) (CD5/2416), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (2F6), CF640R conjugate, 0.1mg/mL
BNC401014-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (2F6), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details