Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus 4,4'-diaponeurosporenoate glycosyltransferase (crtQ)

This Recombinant Staphylococcus aureus 4,4'-diaponeurosporenoate glycosyltransferase (crtQ) spans the amino acid sequence from region 1-375.

Product Specifications

Product Name Alternative

4,4'-diaponeurosporenoate glycosyltransferase, EC= 2.4.1.-

UniProt

Q99R74

Expression Region

1-375

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKWLSRILTVIVTMSMACGALIFNRRHQLKTKTLNFNHKALTIIIPARNEEKRIGHLLHS IIQQQVPVDVIVMNDGSTDETARVARSYGATVVDVVDDTDGKWYGKSHACYQGVTHACTN RIAFVDADVTFLRKDAVETLINQYQLQGEKGLLSVQPYHITKRFYEGFSAIFNLMTVVGM NVFSTLDDGRTNQHAFGPVTLTNKEDYYATGGHKSANRHIIEGFALGSAYTSQSLPVTVY EGFPFVAFRMYQEGFQSLQEGWTKHLSTGAGGTKPKIMTAIVLWLFGSIASILGLCLSLK YRQMSVRKMVALYLSYTTQFIYLHRRVGQFSNLLMVCHPLLFMFFTKIFIQSWKQTHRYG VVEWKGRQYSISKEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (NKI-beteb), CF647 conjugate, 0.1mg/mL
BNC470226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL
BNC472848-100 1x 100 µL

Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF568 conjugate, 0.1mg/mL
BNC680270-500 1x 500 µL

Fibronectin (HFN7.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL
BNC700977-100 1x 100 µL

TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BCL-10 (BL10/411), CF568 conjugate, 0.1mg/mL
BNC680411-500 1x 500 µL

BCL-10 (BL10/411), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44v9 (Marker of Tumor Metastasis) (CD44v9/2344R), CF488A conjugate, 0.1mg/mL
BNC882344-500 1x 500 µL

CD44v9 (Marker of Tumor Metastasis) (CD44v9/2344R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details