Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Proton extrusion protein PcxA (pcxA)

This Recombinant Prochlorococcus marinus Proton extrusion protein PcxA (pcxA) spans the amino acid sequence from region 1-376.

Product Specifications

Product Name Alternative

Proton extrusion protein PcxA

UniProt

A2C9Q5

Expression Region

1-376

Origin

Prochlorococcus marinus (strain MIT 9303)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRTFGEARSIDINNDLERGYEAALLIQTLELEYYGDRPIRPNLQLSVPRSLQSTILRKFH TAVNICRLTFEAIKPNISQLDSQEYRKFQLIETIVNRYAPKRSSRSTSMSRAPDPLPRSL LGLVDKVRRQLDPTSEATLVAGFRRRRDSTLISLKIILLLILVPLLVQQMSRTYLITPAI DYLAPDLPFLSYPKPQLEEQAVEKLRVFKAEIEFDALLKGDSIPSQDELQKALVIKANQL KDEADKESTHAVKNVLADIAALIAFAFVCIINREELRVLRGFLDEAVYGLSDSAKAFAII LFTDMFVGFHSPEGWQVLLQGIANHFGFPARENFILLFIATFPVILATIFKYWIFRYLNR VSPSSVATLRGMNGSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hps3 Rabbit Polyclonal Antibody (FITC)
orb2145147 100 µL

Hps3 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
MTBP Antibody, HRP conjugated
CSB-PA856921LB01HU-01 50 µg

MTBP Antibody, HRP conjugated

Sign In for Pricing
View Details
MTBP Antibody, HRP conjugated
CSB-PA856921LB01HU-02 100 µg

MTBP Antibody, HRP conjugated

Sign In for Pricing
View Details
CD11a/CD18 Antibody (FITC)
orb432174 0.1 mg

CD11a/CD18 Antibody (FITC)

Sign In for Pricing
View Details
Mouse A330009N23Rik activation kit by CRISPRa
GA217055 1 Kit

Mouse A330009N23Rik activation kit by CRISPRa

Sign In for Pricing
View Details
Human FBXO15 Pre-designed siRNA Set B
SI005535B 1 Each

Human FBXO15 Pre-designed siRNA Set B

Sign In for Pricing
View Details