Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lysocardiolipin acyltransferase 1 (Lclat1)

This Recombinant Mouse Lysocardiolipin acyltransferase 1 (Lclat1) spans the amino acid sequence from region 1-376.

Product Specifications

Product Name Alternative

Lysocardiolipin acyltransferase 1, EC= 2.3.1.-, EC= 2.3.1.51, Acyl-CoA:lysocardiolipin acyltransferase 1

UniProt

Q3UN02

Expression Region

1-376

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSWKGIYFILFLFAGSFFGSIFMLGPILPLMFINLSWYRWISSRLVATWLTLPVALLET MFGVRVVITGDAFVPGERSVIIMNHRTRVDWMFLWNCLMRYSYLRVEKICLKSSLKSVPG FGWAMQVAAFIFIHRKWKDDKSHFEDMIDYFCAIHEPLQLLIFPEGTDLTENNKARSNDF AEKNGLQKYEYVLHPRTTGFTFVVDRLREGKNLDAVHDITVAYPYNIPQTEKHLLLGDFP KEIHFHVQRYPADSLPTSKEDLQLWCHRRWEEKEERLRSFYQGEKNFHFTGQSTVPPCKS ELRVLVVKLLSIVYWALFCSAMCLLIYLYSPVRWYFIISIVFFVLQERIFGGLEIIELAC YRFLHKHPHLNSKKNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL
BNC040978-100 1x 100 µL

CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
BNC550017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL
BNC740460-100 1x 100 µL

CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF488A conjugate, 0.1mg/mL
BNC880039-500 1x 500 µL

CD34 (ICO-115), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL
BNC040043-500 1x 500 µL

P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF647 conjugate, 0.1mg/mL
BNC470322-500 1x 500 µL

CD3e (RIV9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details