Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Transmembrane protein 237A (tmem237a)

This Recombinant Danio rerio Transmembrane protein 237A (tmem237a) spans the amino acid sequence from region 1-377.

Product Specifications

Product Name Alternative

Transmembrane protein 237A, Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 4 protein homolog A

UniProt

F1Q930

Expression Region

1-377

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MCVTSRADKMPSVKPKKKKIKKEINEVEEPEAGPEPAIEMEGLESRRQSESREPLTPEPH DNPPLKKKKKKKTHTFENEGEQQDHPNGDVQESPTDGEEVTKKSKKKRKNKMMENQSHNE LGVEEDDIITDVHAPISQRSLFSAPLSHSHPIGKVFVEKNRRFQATDLSHDHLEEYMEVR PMWNTRDVAMRVHSGFRIIGLFSHGFLAGYAVWNIIVVYVLAGEQMTTLPNLLQQYHSLA YPAQSLLYLLLAISTVSAFDRVNLAKASMALRGFLTLDPAALASFLYFAALILSLSQQMT SDRIHLYPTANETLWPPGLEHQILQPWIVVNLVVALLVGLAWVFVATRPDMDYTEEFLMA MEVEEYPRHDDKHELAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (G3.1), CF568 conjugate, 0.1mg/mL
BNC680861-100 1x 100 µL

HSP27 (G3.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF647 conjugate, 0.1mg/mL
BNC470871-500 1x 500 µL

CD71 (66IG10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (8C8), CF740 conjugate, 0.1mg/mL
BNC740005-100 1x 100 µL

Bcl-2 (8C8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rEGP40/1110), CF647 conjugate, 0.1mg/mL
BNC472347-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rEGP40/1110), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ki-67 (Proliferating Cell Marker) (MKI67/2465), CF647 conjugate, 0.1mg/mL
BNC472465-500 1x 500 µL

Ki-67 (Proliferating Cell Marker) (MKI67/2465), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (Hematopoietic Stem Cell & Endothelial Marker) (HPCA1/2598R), CF568 conjugate, 0.1mg/mL
BNC682598-500 1x 500 µL

CD34 (Hematopoietic Stem Cell & Endothelial Marker) (HPCA1/2598R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details