Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0704 (MJ0704)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0704 (MJ0704) spans the amino acid sequence from region 1-377.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0704

UniProt

Q58115

Expression Region

1-377

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFAFEGFKWEIVEIFDWKGLKKLQTTFQNYLLILSMIVSIAVVVAIKNYDSLWSLITNSS DSSNFLTVGSILATISALLVSISWVIIQTSSDRLSNILMWIWVRDVRFLTFVVISFTTVF LFILISLTHVQLHVIDYGIIYYVIMLNFLMYALYIKAFANVINPKYAVDLILRDKDIGDK SGGYGDLTDAESRLFAVYEIIEKRIKVGDVYAVIKCLNMINKNFNKYWMFIKDEKREKYL RDFLRILSKLRVEYRKNCLNRKNKPYSKKGLEAFKKTEFIVSFYKTIEEKIKTRDINSIN KFLSETYNNISNYEMFNDKTYLEIFVHHLKELLEKYEKEKNENKLDEEIFNELKDELEKL INKCNNKLRELESQNNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1810037I17Rik ORF Vector (Mouse) (pORF)
ORF036897 1.0 µg DNA

1810037I17Rik ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Plekhj1 Rat shRNA Plasmid (Locus ID 314634)
TL706616 1 Kit

Plekhj1 Rat shRNA Plasmid (Locus ID 314634)

Sign In for Pricing
View Details
Mouse Monoclonal CD4 Antibody (RPA-T4) [Janelia Fluor 525]
FAB37912JF525 0.1 mL

Mouse Monoclonal CD4 Antibody (RPA-T4) [Janelia Fluor 525]

Sign In for Pricing
View Details
Olfr1350 CRISPR Activation Plasmid (m)
sc-434535-ACT 20 µg

Olfr1350 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Phospho-STAT1 (Ser727) Polyclonal Antibody APC Conjugated
orb1540144 100 µL

Phospho-STAT1 (Ser727) Polyclonal Antibody APC Conjugated

Sign In for Pricing
View Details
Recombinant Human cytomegalovirus Uncharacterized protein UL78 (UL78), partial
MBS7059678 Inquire

Recombinant Human cytomegalovirus Uncharacterized protein UL78 (UL78), partial

Sign In for Pricing
View Details