Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas aeruginosa Alkane 1-monooxygenase 2 (alkB2)

This Recombinant Pseudomonas aeruginosa Alkane 1-monooxygenase 2 (alkB2) spans the amino acid sequence from region 1-377.

Product Specifications

Product Name Alternative

Alkane 1-monooxygenase 2, EC= 1.14.15.3, Alkane hydroxylase, AHs, Terminal alkane hydroxylase

UniProt

Q6H941

Expression Region

1-377

Origin

Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFASLSSAWMLRLKKYGYWIWLIAVLGIPLSYWWSLGSDYPNAWPWLVISVVFGLIPILD AIVGRDPANPEEASEVPEMEAQGYYRVLSLATVPLLLGMLVWSGWILAHETRWDWVGQLG WILSVGTVMGAIGITVSHELIHKDPQLEQNAGGLLLAAVCYAGFKVEHVRGHHVHVSTPE DASSSRYGQSLYSFLPHAYKHNFLNAWRLEAERLKRKGLPALHWRNELIWWYAISALFLL GFSLAFGWLGAIFFLGQSVMAFTLLEIVNYVEHYGLHRRRLDNGRYERTTPEHSWNSNFL LTNLFLFHLQRHSDHHAYAKRRYQVLRHYDSSPQLPNGYAGMIVLALFPPLWRAVMDPKV RAYYAGEEYQLTDTQRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL
BNC740009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL
BNC940679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL
BNC400437-500 1x 500 µL

CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL
BNC400965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (A53-B/A2.26 + BA17), CF568 conjugate, 0.1mg/mL
BNC680753-500 1x 500 µL

Cytokeratin 19 (A53-B/A2.26 + BA17), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100B (S100B/1012), CF488A conjugate, 0.1mg/mL
BNC881012-100 1x 100 µL

S100B (S100B/1012), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details