Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Lysocardiolipin acyltransferase 1 (LCLAT1)

This Recombinant Chicken Lysocardiolipin acyltransferase 1 (LCLAT1) spans the amino acid sequence from region 1-378.

Product Specifications

Product Name Alternative

Lysocardiolipin acyltransferase 1, EC= 2.3.1.-, EC= 2.3.1.51

UniProt

Q5F3X0

Expression Region

1-378

Origin

Gallus gallus (Chicken)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSWKGIYFVVALFLGSFFGSIFMLGPFLPLMFISPAWYRWITDRIVATWLTLPVALLEM VFGAKVVVTGDGFIPGERSVIIMNHRTRMDWMFLWNCLLRYSYLRLEKICLKSSLKSIPG FGWAMQVAAFIFIQRKWEDDKSHFENMLHYFCDIHEPLQLLIFPEGTDLTANTKARSNDF AEKNGLRKYEYVLHPRTTGFTFVVECLREGNNLDAIHDITVAYPQNIPQTEKHLLNGNFP KEIHFHVQRYPIETVPTSKEELQLWCQKRWEEKEERLRRFYEGGKCFDETGQSIIPPCKS ELRVLAVKCISLLYWTVFPMGTFALLYLYSFARWYFAAMIIIFVAQQKIFGGLELIELAC HQYFKKQQKHDDTKMKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 (C16/1045), CF488A conjugate, 0.1mg/mL
BNC881045-100 1x 100 µL

CD16 (C16/1045), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL
BNC881231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF405S conjugate, 0.1mg/mL
BNC040160-100 1x 100 µL

CD20 (B9E9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL
BNC681429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL
BNC400034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (rTGB24), CF568 conjugate, 0.1mg/mL
BNC681967-500 1x 500 µL

Thyroglobulin (Thyroidal Cell Marker) (rTGB24), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details