Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Kluyveromyces lactis Spore membrane assembly protein 2 (SMA2)

This Recombinant Kluyveromyces lactis Spore membrane assembly protein 2 (SMA2) spans the amino acid sequence from region 1-378.

Product Specifications

Product Name Alternative

Spore membrane assembly protein 2

UniProt

Q6CWD4

Expression Region

1-378

Origin

Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)

Field of Research

Neuroscience; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRFKYISFIILISFSLLVWFSHLSNFTCTSSANLPICMPQYVFHFKDDTPTSKVLFSTVK EFFSLLSFFTLDFNWGIDLSELQDRYNQSNLINIFHPSNTYYVNAFGYCKHQAQDEKLNH YCIDNTNGLNIISVLIRDLGFQFGVLSETNVKITGDSFWIIYQTLINSFNKFLEDDKRGN TLLKMITPNDPNEMEQWKTRLWLINIYDAVNVVLKWTVVANCILASLCLMLLLFWMWMQI EHKKTQSPIKQLNWNINSICSITRCLSICNATITFIYILHILLLTFMINCFRYKRLQIIH ASLGTGAWFHIARFFVELIFAVLCFKWMTPHSAMSASVMSETQSTAVEDEEEKDTEDNYS ALNPASGTTAVDGFLLTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF740 conjugate, 0.1mg/mL
BNC741037-100 1x 100 µL

CD44 Standard (DF1485), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL
BNC470225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL
BNC740270-100 1x 100 µL

Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/2558), CF405S conjugate, 0.1mg/mL
BNC042558-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/2558), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PD1 / PDCD1 / CD279 (PDCD1/922), CF740 conjugate, 0.1mg/mL
BNC740922-500 1x 500 µL

PD1 / PDCD1 / CD279 (PDCD1/922), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAX6 (PAX6/1166), CF640R conjugate, 0.1mg/mL
BNC401166-100 1x 100 µL

PAX6 (PAX6/1166), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details