Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Proton extrusion protein PcxA (pcxA)

This Recombinant Synechococcus sp. Proton extrusion protein PcxA (pcxA) spans the amino acid sequence from region 1-379.

Product Specifications

Product Name Alternative

Proton extrusion protein PcxA

UniProt

A5GTC7

Expression Region

1-379

Origin

Synechococcus sp. (strain RCC307)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLNDWLGTFAKAEGLDLSSDLEQAYEAALMIQGLELEYFNDRPVRTDVNLGLPQATQTQ IFRRFRSALEICRALLSSIERQRAQLDSQELRQLQLIESVVRRYRSKDGQTLFQRPDPLP RSLLGVFDRVRNQLDPEAEANVVAGFRRRRDSTLVSLRILLLMILVPLLLQQISRTYVIS PLVDRIAPDIPFLSYTKPRLQQSAVASLREYKAEIEFAALLEGEDSPSVEELRQKLTLKA AELKDEADSESTTAIKNVLADVVATIGFVLVCLFGRDEIRVLRGFFDEVVYGLSDNAKAF VIILFTDIFVGFHSPEGWTVLLQGISSHLGIPAEEQFIDLFIATFPVILATIFKYWIFRY LNRVSPSSVTTLRGMNGGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHARP2 Rabbit Polyclonal Antibody (BF555)
orb2466003 100 µL

SHARP2 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
NANOS2 (NM_001029861) Human Tagged Lenti ORF Clone
RC212815L4 10 µg

NANOS2 (NM_001029861) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Phospho-ATP1A1 (Tyr10) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-3034R-BF647 100 µL

Phospho-ATP1A1 (Tyr10) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
WDR59 Human qPCR Primer Pair (NM_030581)
HP215345 200 Reactions

WDR59 Human qPCR Primer Pair (NM_030581)

Sign In for Pricing
View Details
F/IMO185-PP-PHOLUMB-150x150/1-B Marine & IMO Signs (No Adhesive)
195287 1 Pack (1 Panel (s) x 1 Pack)

F/IMO185-PP-PHOLUMB-150x150/1-B Marine & IMO Signs (No Adhesive)

Sign In for Pricing
View Details
ZFP583 (Zinc Finger Protein 583)
496015 100 µL

ZFP583 (Zinc Finger Protein 583)

Sign In for Pricing
View Details