Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus subsp. pastoris Membrane protein insertase YidC (yidC)

This Recombinant Prochlorococcus marinus subsp. pastoris Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 1-379.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

Q7V0R8

Expression Region

1-379

Origin

Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIGFISEKLLIPILDFFYGLVPSYGLAIVALTVVIRIALFPLSAGSIRSARRMKIAQPVM QKRQAEIKSKFSSDPKKQQEELGKLMNEFGSPLAGCLPLIVQMPVLFALFATLRGSPFAD VPYNINLKVLPQDQIAAIDPKPYKSPRHSIFVTEKSHFPVIATLPNGTKLGSEESVKINL QTTNGNNYSEVLSNYDNGSRFLPTWTVSKGSENIKVSQDGLVTAIKPGDATIEAKIPGLA AKSGFLFIKALGQVGFYVDGSINWDIATLVGAFGLTLLLSQVLSSQGMPSNAQQSTANKI TPVMITGMFLFFPLPAGVLLYMVVANIFQAFQTFLLNKEALPANLQKILDDQLTGKNKVI PSTANISDKRLPFEPNNKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BNIP3L Antibody
KC-7917-01 50 μL

BNIP3L Antibody

Sign In for Pricing
View Details
BNIP3L Antibody
KC-7917-02 100 µL

BNIP3L Antibody

Sign In for Pricing
View Details
BNIP3L Antibody
KC-7917-03 1 mL

BNIP3L Antibody

Sign In for Pricing
View Details
MTAP (Tumor Suppressor Marker) (MTAP/3137R), CF405S conjugate, 0.1mg/mL
BNC043137-500 1x 500 µL

MTAP (Tumor Suppressor Marker) (MTAP/3137R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTL7B (N-term) Rabbit Polyclonal Antibody
AP50070PU-N 400 µL

ACTL7B (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HRASLS3 (PLA2G16) Rabbit Polyclonal Antibody
TA371906 100 µL

HRASLS3 (PLA2G16) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details