Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Membrane protein insertase YidC (yidC)

This Recombinant Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 1-380.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

Q50205

Expression Region

1-380

Origin

Mycobacterium leprae

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVFTLRALLYKPF VRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQREHGFNPILGCLPMLAQIPVF LGLYHALRSFNRTTGGFGQPHMSVTENRMTGNYVFTPVDVGHFLDANLWGAPIGAYMTQR SGLDAFIDFSRPAVILVGIPMMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYV FPFGVVVGGPFLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATTPADKPDCVGY NNNPTSHTRRSGQRTKRRKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCR6 sgRNA CRISPR Lentivector (Human) (Target 3)
K0395204 1.0 µg DNA

CCR6 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
SLC27A6 Protein Vector (Human) (pPM-C-His)
PV038596 500 ng

SLC27A6 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Micro Carboxylesterase (CarE) Assay Kit
OM625944 100 Tests

Micro Carboxylesterase (CarE) Assay Kit

Sign In for Pricing
View Details
Lentiviral human TCEANC2 shRNA (UAS) - Lentiviral human TCEANC2 shRNA (UAS) plasmid
GTR15108463 1 Vial

Lentiviral human TCEANC2 shRNA (UAS) - Lentiviral human TCEANC2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Mouse Monoclonal OSMR beta Antibody (469221) [Allophycocyanin/Cy7]
FAB4389APCCY7 0.1 mL

Mouse Monoclonal OSMR beta Antibody (469221) [Allophycocyanin/Cy7]

Sign In for Pricing
View Details
Human Transcriptional Regulating Factor 1 (TRERF1) Protein
abx650190-01 10 µg

Human Transcriptional Regulating Factor 1 (TRERF1) Protein

Sign In for Pricing
View Details