Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Membrane protein insertase YidC (yidC)

This Recombinant Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 1-380.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

Q50205

Expression Region

1-380

Origin

Mycobacterium leprae

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVFTLRALLYKPF VRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQREHGFNPILGCLPMLAQIPVF LGLYHALRSFNRTTGGFGQPHMSVTENRMTGNYVFTPVDVGHFLDANLWGAPIGAYMTQR SGLDAFIDFSRPAVILVGIPMMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYV FPFGVVVGGPFLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATTPADKPDCVGY NNNPTSHTRRSGQRTKRRKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin I2 antibody
MBS837714-01 0.1 mL

Cyclin I2 antibody

Sign In for Pricing
View Details
Cyclin I2 antibody
MBS837714-02 5x 0.1 mL

Cyclin I2 antibody

Sign In for Pricing
View Details
FEZ2 Human qPCR Primer Pair (NM_005102)
HP226835 200 Reactions

FEZ2 Human qPCR Primer Pair (NM_005102)

Sign In for Pricing
View Details
ENPP3 Recombinant Rabbit mAb, Pacific Blue conjugated
orb3126721 100 µL

ENPP3 Recombinant Rabbit mAb, Pacific Blue conjugated

Sign In for Pricing
View Details
PD-1 (Intracellular Domain) Rabbit mAb
C06500-01 20 µL

PD-1 (Intracellular Domain) Rabbit mAb

Sign In for Pricing
View Details
PD-1 (Intracellular Domain) Rabbit mAb
C06500-02 100 µL

PD-1 (Intracellular Domain) Rabbit mAb

Sign In for Pricing
View Details