Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable palmitoyltransferase ZDHHC20 (Zdhhc20)

This Recombinant Mouse Probable palmitoyltransferase ZDHHC20 (Zdhhc20) spans the amino acid sequence from region 1-380.

Product Specifications

Product Name Alternative

Probable palmitoyltransferase ZDHHC20, EC= 2.3.1.-, Zinc finger DHHC domain-containing protein 20, DHHC-20

UniProt

Q5Y5T1

Expression Region

1-380

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPWTLWRCCQRVVGWVPVLFITFVVVWSYYAYVVELCVSTISRTGEKGKTVVYLVAFHL FFVMFVWSYWMTIFTSPASPSKEFYLSNSEKERYEKEFSQERQQDILRRAARDLPIYTTS ASKAIRYCEKCQLIKPDRAHHCSACDRCVLKMDHHCPWVNNCVGFTNYKFFMLFLLYSLL YCLFVAATVLEYFIKFWTLCRRKSTENCPKNEPTVLNFPSAKFHVLFLFFVSAMFFVSVL SLFSYHCWLVGKNRTTIESFRAPMFSYGIDGNGFSLGCSKNWRQVFGDEKKYWLVPIFSS LGDGCSFPARLVGMDPEQASVANQSDYVRSIGSNQPFPIKPLSESKNRLLDSESQWLENG AEEGVTKSGTNNHVTVEIEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL
BNC681003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL
BNC740043-500 1x 500 µL

P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IgD26), CF488A conjugate, 0.1mg/mL
BNC882097-500 1x 500 µL

Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IgD26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytochrome C (CYCS/1010), CF594 conjugate, 0.1mg/mL
BNC941010-100 1x 100 µL

Cytochrome C (CYCS/1010), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (Suprabasal Epithelial Marker) (AE20), CF568 conjugate, 0.1mg/mL
BNC681274-500 1x 500 µL

Cytokeratin 10 (Suprabasal Epithelial Marker) (AE20), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), Biotin conjugate, 0.1mg/mL
BNCB0342-100 1x 100 µL

CD43 (84-3C1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details