Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Gap junction alpha-1 protein (GJA1)

This Recombinant Rabbit Gap junction alpha-1 protein (GJA1) spans the amino acid sequence from region 2-382.

Product Specifications

Product Name Alternative

Gap junction alpha-1 protein, Connexin-43, Cx43

UniProt

Q6TYA7

Expression Region

2-382

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGC ENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDGV NVEMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSVFEVAFLLIQWYIYGFSL SAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRVK GKSDPYHATTGPLSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNY NKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQ RPSSRASSRASSRPRPDDLEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF111 Antibody (N-term)
E45R04326G-4 50 µL

RNF111 Antibody (N-term)

Sign In for Pricing
View Details
Goat Colon Cancer Specific Antigene-4 ELISA Kit
MBS031797 Inquire

Goat Colon Cancer Specific Antigene-4 ELISA Kit

Sign In for Pricing
View Details
Brain Occipital Lobe Tissue Slides (Multiple Sclerosis) - (Dry Ice)
NBP2-77682 5 Slides

Brain Occipital Lobe Tissue Slides (Multiple Sclerosis) - (Dry Ice)

Sign In for Pricing
View Details
SP1 ELISA Kit (Human) (OKAN04776)
OKAN04776 96 Well

SP1 ELISA Kit (Human) (OKAN04776)

Sign In for Pricing
View Details
Mouse Adam3 (NM_009619) AAV Particle
MR221829A1V 250 µL

Mouse Adam3 (NM_009619) AAV Particle

Sign In for Pricing
View Details
Human Dipeptidase 1, Renal (DPEP1) ELISA Kit
MBS456057-01 48 Tests

Human Dipeptidase 1, Renal (DPEP1) ELISA Kit

Sign In for Pricing
View Details