Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Gap junction alpha-1 protein (GJA1)

This Recombinant Rabbit Gap junction alpha-1 protein (GJA1) spans the amino acid sequence from region 2-382.

Product Specifications

Product Name Alternative

Gap junction alpha-1 protein, Connexin-43, Cx43

UniProt

Q6TYA7

Expression Region

2-382

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGC ENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDGV NVEMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSVFEVAFLLIQWYIYGFSL SAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRVK GKSDPYHATTGPLSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNY NKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQ RPSSRASSRASSRPRPDDLEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR68 Polyclonal Antibody, PerCP Conjugated
bs-13682R-PerCP 100 µL

WDR68 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Stem Cell Factor Receptor, Fc Chimera, Human (Mast/stem Cell Growth Factor Receptor, SCFR, Proto-oncogene Tyrosine-protein Kinase Kit, C-kit, CD117)
215473 50 µg

Stem Cell Factor Receptor, Fc Chimera, Human (Mast/stem Cell Growth Factor Receptor, SCFR, Proto-oncogene Tyrosine-protein Kinase Kit, C-kit, CD117)

Sign In for Pricing
View Details
PITX2/RGS Rabbit Polyclonal Antibody (Carrier-free)
orb3113285 100 µg

PITX2/RGS Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Rabbit Polyclonal Adenylosuccinate Lyase Antibody
NBP2-99767-100ul 100 µL

Rabbit Polyclonal Adenylosuccinate Lyase Antibody

Sign In for Pricing
View Details
Anti-CD46 antibody (DM145), Rabbit mAb
MBS188913-01 0.01 mg

Anti-CD46 antibody (DM145), Rabbit mAb

Sign In for Pricing
View Details
Anti-CD46 antibody (DM145), Rabbit mAb
MBS188913-02 0.1 mg

Anti-CD46 antibody (DM145), Rabbit mAb

Sign In for Pricing
View Details