Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Flagellar biosynthetic protein flhB (flhB)

This Recombinant Buchnera aphidicola subsp. Schizaphis graminum Flagellar biosynthetic protein flhB (flhB) spans the amino acid sequence from region 1-381.

Product Specifications

Product Name Alternative

Flagellar biosynthetic protein flhB

UniProt

Q8K9S1

Expression Region

1-381

Origin

Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHDINEEKTEQPTEHHIKKFRKKGETRYSRELNSLLILIFGLSNLWWSRYSIIFELKTI MFNSFNFNQNILTNQQNISLNFFFFIKKILIVFFPFFSFLICIIIIPPILFGGIKFNFTS LKLNFARLNLLHGLKKFFSFQIFIELFKTTLKLFIISCISIFYLWIYFYKILFLSTKNIS SSLLDGFNVIFYCCILIILGLIPIVILDVFWRQWSYYKKLKMTHQEIKDEFKEREGSPQI KARIRQQMKINLRRRMISDVPKADVIITNPIHYAIALKYDIHKMNAPKVIAKGIGATAMK IQKIALKNGIAIIASPSLARALYRYSEIGQYIPGPLYKAVAEILAWVWKVKKWKREGGIF PEKPKNISVPSELNVTGESND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL
BNC400050-100 1x 100 µL

IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF594 conjugate, 0.1mg/mL
BNC940871-500 1x 500 µL

CD71 (66IG10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL
BNC400977-500 1x 500 µL

TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL
BNC400965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL
BNC940096-500 1x 500 µL

Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL
BNC401073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details