Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Proton extrusion protein PcxA (pcxA)

This Recombinant Synechococcus sp. Proton extrusion protein PcxA (pcxA) spans the amino acid sequence from region 1-382.

Product Specifications

Product Name Alternative

Proton extrusion protein PcxA

UniProt

A5GKT4

Expression Region

1-382

Origin

Synechococcus sp. (strain WH7803)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGRNWLDTFGRAKSLDVNADLDRGYEAALLIQSLELEYYGDRPIRPDLELSVPSSVQAT VLRKFRAAISVCRASLDKLEYQRGELDPQELRQLQLIESVVNRYSPRRTASAPTISRSPD PLPRSLLGIFDTLRRQLNPTAEATLVAGFRRRRDSTLISLKVLLLLILVPLLVQQVSRTY IISPAVDRYAPDLPFLSYPKPQLEEQAVEKLRVYKAEIEFDALLRGDSIPTQEELQKKLS AKAEELKQEADSESTHAVKNVIADLAATVAFVVVCVFSREELRVLRGFFDEAVYGLSDSA KAFAIILFTDIFVGFHSPEGWTVLLDGIANHFGFPARENFILLFIATFPVILATIFKYWI FRYLNRVSPSSVATLRGMNGGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem63a sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4679404 1.0 µg DNA

Tmem63a sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Anti-BRD4 Antibody Picoband®
A00123-2 100 µg/Vial

Anti-BRD4 Antibody Picoband®

Sign In for Pricing
View Details
RRAGA AAV Vector (Rat) (CMV)
42731106 1 µg

RRAGA AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
DEFB108P2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0579206 1.0 µg DNA

DEFB108P2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Rabbit Polyclonal EXOSC3 Antibody
NBP2-16392 0.1 mL

Rabbit Polyclonal EXOSC3 Antibody

Sign In for Pricing
View Details
Olfr352 Mouse qPCR Primer Pair (NM_146940)
MP209848 200 Reactions

Olfr352 Mouse qPCR Primer Pair (NM_146940)

Sign In for Pricing
View Details