Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Proton extrusion protein PcxA (pcxA)

This Recombinant Synechococcus sp. Proton extrusion protein PcxA (pcxA) spans the amino acid sequence from region 1-382.

Product Specifications

Product Name Alternative

Proton extrusion protein PcxA

UniProt

A5GKT4

Expression Region

1-382

Origin

Synechococcus sp. (strain WH7803)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGRNWLDTFGRAKSLDVNADLDRGYEAALLIQSLELEYYGDRPIRPDLELSVPSSVQAT VLRKFRAAISVCRASLDKLEYQRGELDPQELRQLQLIESVVNRYSPRRTASAPTISRSPD PLPRSLLGIFDTLRRQLNPTAEATLVAGFRRRRDSTLISLKVLLLLILVPLLVQQVSRTY IISPAVDRYAPDLPFLSYPKPQLEEQAVEKLRVYKAEIEFDALLRGDSIPTQEELQKKLS AKAEELKQEADSESTHAVKNVIADLAATVAFVVVCVFSREELRVLRGFFDEAVYGLSDSA KAFAIILFTDIFVGFHSPEGWTVLLDGIANHFGFPARENFILLFIATFPVILATIFKYWI FRYLNRVSPSSVATLRGMNGGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPHP3 (NM_153240) Human Untagged Clone
SC309918 10 µg

NPHP3 (NM_153240) Human Untagged Clone

Sign In for Pricing
View Details
Speedy E4 Lentiviral Activation Particles (h)
sc-415773-LAC 200 µL

Speedy E4 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Meis homeobox 3 (MEIS3) (NM_020160) Human Over-expression Lysate
E45H11065-2 20 µg

Meis homeobox 3 (MEIS3) (NM_020160) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-NRBF2 Antibody Picoband®, Carrier-free
A09144-2-carrier-free 100 µg/Vial

Anti-NRBF2 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
ASB9 ORF Vector (Human) (pORF)
ORF000681 1.0 µg DNA

ASB9 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Apoptosis Inducing Factor (AIF, Programmed cell death protein 8, mitochondrial precursor, PDCD8)
A1059-80 100 µg

Apoptosis Inducing Factor (AIF, Programmed cell death protein 8, mitochondrial precursor, PDCD8)

Sign In for Pricing
View Details