Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Proton extrusion protein PcxA (pcxA)

This Recombinant Synechococcus sp. Proton extrusion protein PcxA (pcxA) spans the amino acid sequence from region 1-382.

Product Specifications

Product Name Alternative

Proton extrusion protein PcxA

UniProt

A5GKT4

Expression Region

1-382

Origin

Synechococcus sp. (strain WH7803)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGRNWLDTFGRAKSLDVNADLDRGYEAALLIQSLELEYYGDRPIRPDLELSVPSSVQAT VLRKFRAAISVCRASLDKLEYQRGELDPQELRQLQLIESVVNRYSPRRTASAPTISRSPD PLPRSLLGIFDTLRRQLNPTAEATLVAGFRRRRDSTLISLKVLLLLILVPLLVQQVSRTY IISPAVDRYAPDLPFLSYPKPQLEEQAVEKLRVYKAEIEFDALLRGDSIPTQEELQKKLS AKAEELKQEADSESTHAVKNVIADLAATVAFVVVCVFSREELRVLRGFFDEAVYGLSDSA KAFAIILFTDIFVGFHSPEGWTVLLDGIANHFGFPARENFILLFIATFPVILATIFKYWI FRYLNRVSPSSVATLRGMNGGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RNA Binding Motif Protein 20 (RBM20) ELISA Kit
RD-RBM20-Hu-48Tests 48 Tests

Human RNA Binding Motif Protein 20 (RBM20) ELISA Kit

Sign In for Pricing
View Details
CD62p Recombinant Antibody, PE Conjugated
bsm-60008R-PE-01 20 µL

CD62p Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
CD62p Recombinant Antibody, PE Conjugated
bsm-60008R-PE-02 100 µL

CD62p Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype Ia UPF0176 protein SAK_1469 (SAK_1469)
MBS1429345-01 0.02 mg (E-Coli)

Recombinant Streptococcus agalactiae serotype Ia UPF0176 protein SAK_1469 (SAK_1469)

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype Ia UPF0176 protein SAK_1469 (SAK_1469)
MBS1429345-02 0.02 mg (Yeast)

Recombinant Streptococcus agalactiae serotype Ia UPF0176 protein SAK_1469 (SAK_1469)

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype Ia UPF0176 protein SAK_1469 (SAK_1469)
MBS1429345-03 0.1 mg (E-Coli)

Recombinant Streptococcus agalactiae serotype Ia UPF0176 protein SAK_1469 (SAK_1469)

Sign In for Pricing
View Details