Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Proton extrusion protein PcxA (pcxA)

This Recombinant Synechococcus sp. Proton extrusion protein PcxA (pcxA) spans the amino acid sequence from region 1-382.

Product Specifications

Product Name Alternative

Proton extrusion protein PcxA

UniProt

Q0IAI7

Expression Region

1-382

Origin

Synechococcus sp. (strain CC9311)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFRNWIGAFGKANALDVNSDLDRGYEAALLIQSLELEYYGDRPIRPDLELSVPKSVQAT VLRKFRVAINVCRASLDQLEYQRSQLDPQELRQLQLIESVVNRYSPKRVSTAPTMTRDPD PLPRSLLGVFDKVRRQLNPAGEATLVAGFRRRRDSTLISLKVLLLLILVPLLVQQVSRTY IISPAVDRFAPDLPFLSYPKPQLEEQAVEKLRVYKAEIEFDALLRGDTIPSQEELQQQLG KKASELKEEADAESTHAVKNVLADISATIAFVVVCLFSREELRVLRGFFDEAVYGLSDSA KAFAIILFTDIFVGFHSPEGWTVLLDGIANHFGFPARENFILLFIATFPVILATIFKYWI FRYLNRVSPSSVATLRGMNGGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat anti Human IgG (heavy and light chains), conjugated with Horseradish peroxidase
MBS571556-01 1 mL

Goat anti Human IgG (heavy and light chains), conjugated with Horseradish peroxidase

Sign In for Pricing
View Details
Goat anti Human IgG (heavy and light chains), conjugated with Horseradish peroxidase
MBS571556-02 5x 1 mL

Goat anti Human IgG (heavy and light chains), conjugated with Horseradish peroxidase

Sign In for Pricing
View Details
MSI2 Recombinant Rabbit Monoclonal Antibody
orb2562865-01 25 µL

MSI2 Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
MSI2 Recombinant Rabbit Monoclonal Antibody
orb2562865-02 50 µL

MSI2 Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
MSI2 Recombinant Rabbit Monoclonal Antibody
orb2562865-03 100 µL

MSI2 Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Bleomycin 10mg
A14378-10 10 mg

Bleomycin 10mg

Sign In for Pricing
View Details