Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Proton extrusion protein PcxA (pcxA)

This Recombinant Synechococcus sp. Proton extrusion protein PcxA (pcxA) spans the amino acid sequence from region 1-382.

Product Specifications

Product Name Alternative

Proton extrusion protein PcxA

UniProt

Q0IAI7

Expression Region

1-382

Origin

Synechococcus sp. (strain CC9311)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFRNWIGAFGKANALDVNSDLDRGYEAALLIQSLELEYYGDRPIRPDLELSVPKSVQAT VLRKFRVAINVCRASLDQLEYQRSQLDPQELRQLQLIESVVNRYSPKRVSTAPTMTRDPD PLPRSLLGVFDKVRRQLNPAGEATLVAGFRRRRDSTLISLKVLLLLILVPLLVQQVSRTY IISPAVDRFAPDLPFLSYPKPQLEEQAVEKLRVYKAEIEFDALLRGDTIPSQEELQQQLG KKASELKEEADAESTHAVKNVLADISATIAFVVVCLFSREELRVLRGFFDEAVYGLSDSA KAFAIILFTDIFVGFHSPEGWTVLLDGIANHFGFPARENFILLFIATFPVILATIFKYWI FRYLNRVSPSSVATLRGMNGGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LINC00462 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV731799 1.0 µg DNA

LINC00462 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Mouse COL5a2 (Collagen Type V Alpha 2) ELISA Kit
EK245997 96 Well

Mouse COL5a2 (Collagen Type V Alpha 2) ELISA Kit

Sign In for Pricing
View Details
Human IL-27 (Interleukin 27) ELISA Kit
RE2383H-01 48 Tests

Human IL-27 (Interleukin 27) ELISA Kit

Sign In for Pricing
View Details
Human IL-27 (Interleukin 27) ELISA Kit
RE2383H-02 96 Tests

Human IL-27 (Interleukin 27) ELISA Kit

Sign In for Pricing
View Details
IL-1 beta, murine recombinant
4129-50 50 µg

IL-1 beta, murine recombinant

Sign In for Pricing
View Details
WDTC1 AAV Vector (Human) (CMV)
50392101 1 µg

WDTC1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details