Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Innexin-8 (inx-8)

This Recombinant Innexin-8 (inx-8) spans the amino acid sequence from region 1-382.

Product Specifications

Product Name Alternative

Innexin-8, Protein opu-8

UniProt

Q23593

Expression Region

1-382

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFSVPFLTSLTSHLGITAIDDASDTLSCLITAFLFITAAILTSAKTYVGSAMECWLPQTY SGDWGEFAENYCFLKDTYFYPRQQSMTDIPMYHKERHRLTYYQWSSMYLAVAGIAFMIPK FLWRLSQSTTDMPVVYFCDTANEIKNETEDKRSAKIKEMARFMRTKITSVHTPSLFSFIR MYMVYSVIKILYLVNAIAQFVIIAIFLGQKRNLFWGWTLFMNLLNGITWETTGLFPRVTF CDFQVREMAGNNRDETVECVIGINEFNEKIFLFFWFWLVFLVFSTLIAHFYNAAQIVKPY FIHSLLFAIRDHDIVDQKELFREFGEKYLTMDGKLILSFVKSQSDLVASEVAVEMYSDFL EARDRANIAEDKYNNILKNGKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/2939R), CF594 conjugate, 0.1mg/mL
BNC942939-100 1x 100 µL

Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/2939R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(S)-tert-Butyl 2-((tert-butoxycarbonyl)amino)-6-hydroxyhexanoate
TRC-B117823-25MG 25 mg

(S)-tert-Butyl 2-((tert-butoxycarbonyl)amino)-6-hydroxyhexanoate

Sign In for Pricing
View Details
BEND3 (NM_001080450) Human Recombinant Protein
TP315913L 1 mg

BEND3 (NM_001080450) Human Recombinant Protein

Sign In for Pricing
View Details
QuicKey Pro Mouse Pg (Progesterone) ELISA Kit
E-OSEL-M0006-01 24 Tests

QuicKey Pro Mouse Pg (Progesterone) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Mouse Pg (Progesterone) ELISA Kit
E-OSEL-M0006-02 48 Tests

QuicKey Pro Mouse Pg (Progesterone) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Mouse Pg (Progesterone) ELISA Kit
E-OSEL-M0006-03 96 Tests

QuicKey Pro Mouse Pg (Progesterone) ELISA Kit

Sign In for Pricing
View Details