Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Proton extrusion protein PcxA (pcxA)

This Recombinant Synechococcus sp. Proton extrusion protein PcxA (pcxA) spans the amino acid sequence from region 1-382.

Product Specifications

Product Name Alternative

Proton extrusion protein PcxA

UniProt

Q3AJZ9

Expression Region

1-382

Origin

Synechococcus sp. (strain CC9605)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSRRNWINLFSTSQSVELSGDLERGYDAALLIQSLELEYYGDRQIRPELKLSVPRSVQAT ILRRFKTALSICRSSAAKLSDQRGQLDSQELRQLQLIESIVSRYGSRRSTSSPSISRSPD ALPRSLLGVFDSIRLQLDPSTEDSVVAGFRRRRDTTLISLRVLLLLVLVPLLVSQISGTY LISPAVNQFSPELPFLSYPKPLLEEKAAKKLRLYKQELEFDAFLKGVEPLDDAELRNKLT EKATELKHDADEESLKAIKNVFADLAGLIAFAVVCLMSRDELRVLRGFVDEAVYGLSDSA KAFAIILFTDIFVGYHSPEGWSVLLDGVADHFGLPSSQSFVNLFIATFPVVLATIFKYWI FRYLNRVSPSSVATLKGMNGGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ruvbl2 (NM_011304) AAV Particle
MR226444A1V 250 µL

Mouse Ruvbl2 (NM_011304) AAV Particle

Sign In for Pricing
View Details
MYRIP, CT (MYRIP, SLAC2C, Rab effector MyRIP, Exophilin-8, Myosin-VIIa- and Rab-interacting protein, Synaptotagmin-like protein lacking C2 domains C) (MaxLight 490) discontinued
038767-ML490 100 µL

MYRIP, CT (MYRIP, SLAC2C, Rab effector MyRIP, Exophilin-8, Myosin-VIIa- and Rab-interacting protein, Synaptotagmin-like protein lacking C2 domains C) (MaxLight 490) discontinued

Sign In for Pricing
View Details
CPHL1P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
16750061 1.0 µg DNA

CPHL1P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Salmonella Antibody
GWB-C7A7DE 0.025 mg

Salmonella Antibody

Sign In for Pricing
View Details
Human complex edprostate specific antigen, cPSA ELISA Kit
MBS160728-01 48 Well

Human complex edprostate specific antigen, cPSA ELISA Kit

Sign In for Pricing
View Details
Human complex edprostate specific antigen, cPSA ELISA Kit
MBS160728-02 96 Well

Human complex edprostate specific antigen, cPSA ELISA Kit

Sign In for Pricing
View Details