Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans Palmitoyltransferase ERF2 (ERF2)

This Recombinant Candida albicans Palmitoyltransferase ERF2 (ERF2) spans the amino acid sequence from region 1-382.

Product Specifications

Product Name Alternative

Palmitoyltransferase ERF2, EC= 2.3.1.-, DHHC cysteine-rich domain-containing protein ERF2, Ras protein acyltransferase

UniProt

Q59QL0

Expression Region

1-382

Origin

Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPNLISHYNNTNTRRFKNYQIENQGQSNFIYFLGGRLHTIKTKYPINLITLSLIIIPGI LYIIFELSWQWRNFSPIIVIIFLYIWIISIFHFFKLSTGDAGKLPKNIHLPKKLITITTT TTTTNDNEIDHRNNYKVRGSPPDEYFNTVTLPYWKTNNDNNDNTKISKLANAYHSHGVQV KYCGTCHIWRPSRTSHCNTCQQCILNHDHHCIFLNNCIGQRNYKFFLWFLLYIVIACLYL LIISILQLCHYKFASHKESEIITTFNQSIKTHPISLLLLIYSCLAICYPGLLLAFHIFLT SQNITTREYLNFVYKKPSKSTDGGDGTRGFVNVYNTHSIWENLYINWLGKSNGVSLTFPR DYYHQGDIRFANIEPLGTFTNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Breast
CS626735 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/2754), CF640R conjugate, 0.1mg/mL
BNC402754-100 1x 100 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/2754), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Protein Lysate, Ovary
CP565429 150 µg

Tissue Protein Lysate, Ovary

Sign In for Pricing
View Details
Ɑ-Butyric Acid NHS Ester-ω-Pyridyldithiopropanamido PEG
1320000-44-35.500MG 500 mg

Ɑ-Butyric Acid NHS Ester-ω-Pyridyldithiopropanamido PEG

Sign In for Pricing
View Details
Cd8a Rat Monoclonal Antibody [Clone ID: 53-6.7]
AM08023FC-N 500 µg

Cd8a Rat Monoclonal Antibody [Clone ID: 53-6.7]

Sign In for Pricing
View Details
MALT1 (MALT-Lymphoma Marker) (MT1/3159R), CF647 conjugate, 0.1mg/mL
BNC473159-100 1x 100 µL

MALT1 (MALT-Lymphoma Marker) (MT1/3159R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details