Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans Palmitoyltransferase ERF2 (ERF2)

This Recombinant Candida albicans Palmitoyltransferase ERF2 (ERF2) spans the amino acid sequence from region 1-382.

Product Specifications

Product Name Alternative

Palmitoyltransferase ERF2, EC= 2.3.1.-, DHHC cysteine-rich domain-containing protein ERF2, Ras protein acyltransferase

UniProt

Q59QL0

Expression Region

1-382

Origin

Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPNLISHYNNTNTRRFKNYQIENQGQSNFIYFLGGRLHTIKTKYPINLITLSLIIIPGI LYIIFELSWQWRNFSPIIVIIFLYIWIISIFHFFKLSTGDAGKLPKNIHLPKKLITITTT TTTTNDNEIDHRNNYKVRGSPPDEYFNTVTLPYWKTNNDNNDNTKISKLANAYHSHGVQV KYCGTCHIWRPSRTSHCNTCQQCILNHDHHCIFLNNCIGQRNYKFFLWFLLYIVIACLYL LIISILQLCHYKFASHKESEIITTFNQSIKTHPISLLLLIYSCLAICYPGLLLAFHIFLT SQNITTREYLNFVYKKPSKSTDGGDGTRGFVNVYNTHSIWENLYINWLGKSNGVSLTFPR DYYHQGDIRFANIEPLGTFTNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MDM2 (MDM2/2414), CF568 conjugate, 0.1mg/mL
BNC682414-500 1x 500 µL

MDM2 (MDM2/2414), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant CCN2 Antibody
RC-6373-01 50 μL

Recombinant CCN2 Antibody

Sign In for Pricing
View Details
Recombinant CCN2 Antibody
RC-6373-02 100 µL

Recombinant CCN2 Antibody

Sign In for Pricing
View Details
Recombinant CCN2 Antibody
RC-6373-03 1 mL

Recombinant CCN2 Antibody

Sign In for Pricing
View Details
tert-Butyl 4-Azidopiperidine-1-carboxylate
TRC-B750295-25MG 25 mg

tert-Butyl 4-Azidopiperidine-1-carboxylate

Sign In for Pricing
View Details
Human CDCA7L activation kit by CRISPRa
GA110782 1 Kit

Human CDCA7L activation kit by CRISPRa

Sign In for Pricing
View Details