Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Proton extrusion protein PcxA (pcxA)

This Recombinant Synechococcus sp. Proton extrusion protein PcxA (pcxA) spans the amino acid sequence from region 1-382.

Product Specifications

Product Name Alternative

Proton extrusion protein PcxA

UniProt

Q7U6W9

Expression Region

1-382

Origin

Synechococcus sp. (strain WH8102)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAARNWIGLFSRGEGNNLTNALERGYEAALLIQSLELEFYADRKVRPELELSVPRSVQAT VLRRFHAALQICRSSLSTVTPNRGQLDPQELRQLQLIETVVSRYSGKRSSSKSGMSTAPE LLPRSLLGVFDSVRRQLDPSSEESVVAGFRRRRDSTLASLRILLLLVLVPLLVQQVSNTY IVGPAVERLSPDLSFLSYPKPQLEEVAVEKLRIYKEELEFDALLKGQEPLSSDLLVIKLR ERAQELKQEADQESVQAIKNVLADLAGLMAFVVVCLVSRDQLRVLRGFLDEAIYGLSDSA KAFAIILFTDIFVGYHSPEGWTVLLDGIAHHFGLPTQENFILLFIATFPVILATIFKYWI FRYLNRVSPSSVATLKGMNGGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine7 Anti-Human CD44 Antibody[P2A1]
FCE1837-01 20 Tests

PE/Cyanine7 Anti-Human CD44 Antibody[P2A1]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD44 Antibody[P2A1]
FCE1837-02 100 Tests

PE/Cyanine7 Anti-Human CD44 Antibody[P2A1]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD44 Antibody[P2A1]
FCE1837-03 2x 100 Tests

PE/Cyanine7 Anti-Human CD44 Antibody[P2A1]

Sign In for Pricing
View Details
ARRDC3 Human siRNA Oligo Duplex (Locus ID 57561)
SR311565 1 Kit

ARRDC3 Human siRNA Oligo Duplex (Locus ID 57561)

Sign In for Pricing
View Details
TRIM63 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV693359 1.0 µg DNA

TRIM63 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
3,3-difluoro-2,3-dihydro-1H-inden-1-amine hydrochloride
PC99642-01 50 mg

3,3-difluoro-2,3-dihydro-1H-inden-1-amine hydrochloride

Sign In for Pricing
View Details