Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Proton extrusion protein PcxA (pcxA)

This Recombinant Synechococcus sp. Proton extrusion protein PcxA (pcxA) spans the amino acid sequence from region 1-382.

Product Specifications

Product Name Alternative

Proton extrusion protein PcxA

UniProt

Q7U6W9

Expression Region

1-382

Origin

Synechococcus sp. (strain WH8102)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAARNWIGLFSRGEGNNLTNALERGYEAALLIQSLELEFYADRKVRPELELSVPRSVQAT VLRRFHAALQICRSSLSTVTPNRGQLDPQELRQLQLIETVVSRYSGKRSSSKSGMSTAPE LLPRSLLGVFDSVRRQLDPSSEESVVAGFRRRRDSTLASLRILLLLVLVPLLVQQVSNTY IVGPAVERLSPDLSFLSYPKPQLEEVAVEKLRIYKEELEFDALLKGQEPLSSDLLVIKLR ERAQELKQEADQESVQAIKNVLADLAGLMAFVVVCLVSRDQLRVLRGFLDEAIYGLSDSA KAFAIILFTDIFVGYHSPEGWTVLLDGIAHHFGLPTQENFILLFIATFPVILATIFKYWI FRYLNRVSPSSVATLKGMNGGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TTC22 (NM_001114108) AAV Particle
RC225966A1V 250 µL

Human TTC22 (NM_001114108) AAV Particle

Sign In for Pricing
View Details
GNAZ Antibody
orb107463 100 µL

GNAZ Antibody

Sign In for Pricing
View Details
2- (4-Fluorophenyl) -3-nitronaphthalene
PC440012 1 Each

2- (4-Fluorophenyl) -3-nitronaphthalene

Sign In for Pricing
View Details
BCKDHA Protein Lysate (Rat) with C-HA Tag
13219036 100 µg

BCKDHA Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Human OR6Y1 Knockout HEK293T cell line
GTR15419562 1 Vial

Human OR6Y1 Knockout HEK293T cell line

Sign In for Pricing
View Details
Mouse BTB/POZ domain containing protein KCTD8 (KCTD8) ELISA kit
GTR10460128 96 Well

Mouse BTB/POZ domain containing protein KCTD8 (KCTD8) ELISA kit

Sign In for Pricing
View Details