Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Proton extrusion protein PcxA (pcxA)

This Recombinant Prochlorococcus marinus Proton extrusion protein PcxA (pcxA) spans the amino acid sequence from region 1-382.

Product Specifications

Product Name Alternative

Proton extrusion protein PcxA

UniProt

Q7V7J6

Expression Region

1-382

Origin

Prochlorococcus marinus (strain MIT 9313)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLRDWMRTFGEARSIDINNDLERGYEAALLIQTLELEYYGDRPIRPNLQLSVPRSLQST ILRKFHTAANICRLTFEAIKPNVSQLDSQEYRKYQLIETIVNRYAPKRSSRSTSISRAPD ALPRSLLGLVDKVRRQLDPTSEATLVAGFRRRRDSTLISLKIILLLILVPLLVQQISRTY LITPAIDYLAPELPFLSYPKPQLEEQAVEKLRVFKAEIEFDALLKGDSIPSQDELQKALA IKAIQLKDEADKESTHAIKNVLADLAALIAFAFVCIINREELRVLRGFLDEAIYGLSDSA KAFAIILFTDMFVGFHSPEGWQVLLQGIANHFGFPARENFILLFIATFPVILATIFKYWI FRYLNRVSPSSVATLRGMNGSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Epiplakin Protein, His, E.coli-10ug
QP5991-ec-10ug 10ug

Recombinant Human Epiplakin Protein, His, E.coli-10ug

Sign In for Pricing
View Details
Sheep Olfactory receptor 14J1 (OR14J1) ELISA Kit
MBS7233301-01 48 Well

Sheep Olfactory receptor 14J1 (OR14J1) ELISA Kit

Sign In for Pricing
View Details
Sheep Olfactory receptor 14J1 (OR14J1) ELISA Kit
MBS7233301-02 96 Well

Sheep Olfactory receptor 14J1 (OR14J1) ELISA Kit

Sign In for Pricing
View Details
Sheep Olfactory receptor 14J1 (OR14J1) ELISA Kit
MBS7233301-03 5x 96 Well

Sheep Olfactory receptor 14J1 (OR14J1) ELISA Kit

Sign In for Pricing
View Details
Sheep Olfactory receptor 14J1 (OR14J1) ELISA Kit
MBS7233301-04 10x 96 Well

Sheep Olfactory receptor 14J1 (OR14J1) ELISA Kit

Sign In for Pricing
View Details
HoxC5 siRNA (m)
sc-75288 10 µM

HoxC5 siRNA (m)

Sign In for Pricing
View Details