Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Proton extrusion protein PcxA (pcxA)

This Recombinant Prochlorococcus marinus Proton extrusion protein PcxA (pcxA) spans the amino acid sequence from region 1-382.

Product Specifications

Product Name Alternative

Proton extrusion protein PcxA

UniProt

Q7V7J6

Expression Region

1-382

Origin

Prochlorococcus marinus (strain MIT 9313)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLRDWMRTFGEARSIDINNDLERGYEAALLIQTLELEYYGDRPIRPNLQLSVPRSLQST ILRKFHTAANICRLTFEAIKPNVSQLDSQEYRKYQLIETIVNRYAPKRSSRSTSISRAPD ALPRSLLGLVDKVRRQLDPTSEATLVAGFRRRRDSTLISLKIILLLILVPLLVQQISRTY LITPAIDYLAPELPFLSYPKPQLEEQAVEKLRVFKAEIEFDALLKGDSIPSQDELQKALA IKAIQLKDEADKESTHAIKNVLADLAALIAFAFVCIINREELRVLRGFLDEAIYGLSDSA KAFAIILFTDMFVGFHSPEGWQVLLQGIANHFGFPARENFILLFIATFPVILATIFKYWI FRYLNRVSPSSVATLRGMNGSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse H3f3b shRNA (UAS) - Lentiviral mouseH3f3b shRNA (UAS, GFP) (25)
GTR15196520 1 Vial

Lentiviral mouse H3f3b shRNA (UAS) - Lentiviral mouseH3f3b shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
C10 shRNA (m) Lentiviral Particles
sc-141815-V 200 µL

C10 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
FADD (Fas (TNFRSF6) -Associated via Death Domain, GIG3, MGC8528, MORT1) (MaxLight 750) discontinued
245923-ML750 100 µL

FADD (Fas (TNFRSF6) -Associated via Death Domain, GIG3, MGC8528, MORT1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
PCMV-SERPINE1 (human) -Neo
BZ62705 1 Vial

PCMV-SERPINE1 (human) -Neo

Sign In for Pricing
View Details
alpha Tubulin (TUBA4A) Rabbit Polyclonal Antibody
TA362555 100 µL

alpha Tubulin (TUBA4A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RNF6 Blocking Peptide
33R-5861 0.1 mg

RNF6 Blocking Peptide

Sign In for Pricing
View Details