Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Membrane protein insertase YidC (yidC)

This Recombinant Prochlorococcus marinus Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 1-382.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

Q7VB00

Expression Region

1-382

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIGFLSDNLLIPILDFFYGLFHSYGIAIVALTIVIRIALFPLSAGSIRSARRMKIAQPVM QKRQAEIKSRYANDPKKQQDELGKLMGEFGSPLAGCLPLLVQMPILFALFATLRGSPFAD VPYLVNLKILPPEQIAAVEPKPFKSPRHSIFISDKDHFPVIASLPGGTKIAAGDSVNIKL ETLSGEKYSNVLGKFENGSKFSPTWKLTKGADLASVSADGTVTAKYPGDATVEGKIPGLA AKSGFLFIKALGQVGFYVDGAINWDIAILVAGFGLTLVISQVLSGQGMPPNPQQATAQKI TPIMITGMFLFFPLPAGVLLYMVIANMFQAFQTFLLNKEALPENLQKILDDQIKNQGKKE LATSPAIDSERLPFEPKSNKQN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spexin 1 mg
6090/1 1 mg

Spexin 1 mg

Sign In for Pricing
View Details
Recombinant Human SH2 Domain-Containing Protein 1A/SH2D1A/SAP/DSHP (N-6His)
CF35-50ug 50 µg

Recombinant Human SH2 Domain-Containing Protein 1A/SH2D1A/SAP/DSHP (N-6His)

Sign In for Pricing
View Details
Mgat5 Mouse shRNA Plasmid (Locus ID 107895)
TR505806 1 Kit

Mgat5 Mouse shRNA Plasmid (Locus ID 107895)

Sign In for Pricing
View Details
Rabbit Polyclonal NT-3 Antibody [Alexa Fluor 700]
NBP2-99182AF700 0.1 mL

Rabbit Polyclonal NT-3 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Mouse Anti-Toxoplasma antibody (IgA) ELISA KIT ELISA KIT
ED0091Mo-01 96 Well

Mouse Anti-Toxoplasma antibody (IgA) ELISA KIT ELISA KIT

Sign In for Pricing
View Details
Mouse Anti-Toxoplasma antibody (IgA) ELISA KIT ELISA KIT
ED0091Mo-02 5x 96 Tests

Mouse Anti-Toxoplasma antibody (IgA) ELISA KIT ELISA KIT

Sign In for Pricing
View Details