Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Flagellar biosynthetic protein flhB (flhB)

This Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Flagellar biosynthetic protein flhB (flhB) spans the amino acid sequence from region 1-383.

Product Specifications

Product Name Alternative

Flagellar biosynthetic protein flhB

UniProt

P57334

Expression Region

1-383

Origin

Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHNTNEEKTEHPTEHRIRKFRKKGKTRYSRELSSLFILLVGFINLWWYRDLIVLNFSKI MSDSFLFESNDFLNNNNNLLKILMSLKEILFSFFPFLISLLIVIIIPPILFSGISLNFRS LTLNFSKLNPFHGFKRLFSFQIIVEFFKIILKLFIVSIISFWYLQFSFSEILFLVNANYV SSLSHGYNIIFSCCFLVILGLFPIVFFDIAWQQFNYYKKLKMTRQEMRDELKEKEGNPNI KMRIRQAMKAVMRRRMIINTPKADVIITNPIHYSVALKYDEKNMNAPKVIAKGIGEAAIK IQNLALKHNISIISVPSLARSLYRYSEIGQYIPGPLYKAVAEVLAWVWKVRKWKKEGGIF PEKPINISVPSELTFTGEHETND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL
BNC040270-100 1x 100 µL

Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL
BNC880040-500 1x 500 µL

CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL
BNC940017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF568 conjugate, 0.1mg/mL
BNC681035-500 1x 500 µL

CD8 (C8/1035), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL
BNC880225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TCL1 (T-Cell Marker) (TCL1/2078), CF640R conjugate, 0.1mg/mL
BNC402078-100 1x 100 µL

TCL1 (T-Cell Marker) (TCL1/2078), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details