Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Proton extrusion protein PcxA (pcxA)

This Recombinant Synechococcus sp. Proton extrusion protein PcxA (pcxA) spans the amino acid sequence from region 1-383.

Product Specifications

Product Name Alternative

Proton extrusion protein PcxA

UniProt

Q3AXS7

Expression Region

1-383

Origin

Synechococcus sp. (strain CC9902)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSRRNWVNFFSRGQGFDLTNDLERGYESALLIQNLELEFYGDRLVRSDVELGVPKSVQAS ILRRFRAALLICRTTLESVERNRGQFDLQELRQLQLIEAVVSRYGYQLPSGGSPAISRAP EALPRSLLGFFDTVRRQLDPASEETVVAGFRRRRNSTLISLRILLLLILVPLLIQQVAGA YIISPAVDRLSPELPFLSYPKPKLEEQAVEKLRVYKQELEFDALLNSDQPLEADQLRQKL AEKAIELKDEADGLSVQAVKNVFSDLSALIAFTVVCFASRDDLRVMRGFFDEAVYGLSDS AKAFAIILFTDIFVGFHSPEGWTVLLNGIAKHLGLPSQENFVMLFIATFPVILATIFKYW IFRYLNRVSPSSVATLKGMNGSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FTβ shRNA Plasmid (r)
sc-77354-SH 20 µg

FTβ shRNA Plasmid (r)

Sign In for Pricing
View Details
Slc17a9 (NM_001108613) Rat Tagged Lenti ORF Clone
RR201543L4 10 µg

Slc17a9 (NM_001108613) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal KIBRA Antibody
NBP3-35721-100ul 100 µL

Rabbit Polyclonal KIBRA Antibody

Sign In for Pricing
View Details
Recombinant Mouse Prolactin Receptor Protein
CRP3035-01 10 µg

Recombinant Mouse Prolactin Receptor Protein

Sign In for Pricing
View Details
Recombinant Mouse Prolactin Receptor Protein
CRP3035-02 50 µg

Recombinant Mouse Prolactin Receptor Protein

Sign In for Pricing
View Details
Recombinant Mouse Prolactin Receptor Protein
CRP3035-03 500 µg

Recombinant Mouse Prolactin Receptor Protein

Sign In for Pricing
View Details