Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Flagellar biosynthetic protein flhB (flhB)

This Recombinant Flagellar biosynthetic protein flhB (flhB) spans the amino acid sequence from region 1-383.

Product Specifications

Product Name Alternative

Flagellar biosynthetic protein flhB

UniProt

Q56886

Expression Region

1-383

Origin

Yersinia enterocolitica

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEDSDADKSEEPTAHKLEKAREKGQIPRSRELTSMLMLGAGLAILWVSGESMARQLAAM IAQGLHFDHGLISDDKQMLRQIGMLLRQTLIGLIPIFAGLVIVAMAVPMLLGGVLFSGES IKFDLKRMSPIAGLKRMFSSQALAELLKAILKATLVGWVTGIFLWHNWPDMMRLMAAPPV AALGDALHLIIFCGLVVVLGLTPMVGFDVFFQITSHIKKLRMTKQEIRDEFKDQEGDPHV KGRIRQQQRAMARRRMMADVHKADVIVTNPTHYAVALQYNETKMSAPKVLAKGAGAVALR IRELGAEHRIPLLEAPPLARALFRHSEVGQHIPATLYAAVAEVLAWVYQLKRWKREGGLI PKKPEHLPVPEGLDFATEESETD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KDM5D Polyclonal Antibody
ANT-12883-100ug 100 µg

KDM5D Polyclonal Antibody

Sign In for Pricing
View Details
Magnesium Ionophore VI
B2024725 10 mg

Magnesium Ionophore VI

Sign In for Pricing
View Details
PDGFRA (Y720) (Alpha-type Platelet-derived Growth Factor Receptor, PDGF-R-alpha, CD140 Antigen-like Family Member A, CD140a Antigen, CD140a) (Azide free) (HRP)
MBS6493886-01 0.2 mL

PDGFRA (Y720) (Alpha-type Platelet-derived Growth Factor Receptor, PDGF-R-alpha, CD140 Antigen-like Family Member A, CD140a Antigen, CD140a) (Azide free) (HRP)

Sign In for Pricing
View Details
PDGFRA (Y720) (Alpha-type Platelet-derived Growth Factor Receptor, PDGF-R-alpha, CD140 Antigen-like Family Member A, CD140a Antigen, CD140a) (Azide free) (HRP)
MBS6493886-02 5x 0.2 mL

PDGFRA (Y720) (Alpha-type Platelet-derived Growth Factor Receptor, PDGF-R-alpha, CD140 Antigen-like Family Member A, CD140a Antigen, CD140a) (Azide free) (HRP)

Sign In for Pricing
View Details
Human BCL10 Protein
B2011631 10 µg

Human BCL10 Protein

Sign In for Pricing
View Details
RGL3 Lentiviral Activation Particles (h)
sc-412762-LAC 200 µL

RGL3 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details