Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Flagellar biosynthetic protein flhB (flhB)

This Recombinant Flagellar biosynthetic protein flhB (flhB) spans the amino acid sequence from region 1-383.

Product Specifications

Product Name Alternative

Flagellar biosynthetic protein flhB

UniProt

Q56886

Expression Region

1-383

Origin

Yersinia enterocolitica

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEDSDADKSEEPTAHKLEKAREKGQIPRSRELTSMLMLGAGLAILWVSGESMARQLAAM IAQGLHFDHGLISDDKQMLRQIGMLLRQTLIGLIPIFAGLVIVAMAVPMLLGGVLFSGES IKFDLKRMSPIAGLKRMFSSQALAELLKAILKATLVGWVTGIFLWHNWPDMMRLMAAPPV AALGDALHLIIFCGLVVVLGLTPMVGFDVFFQITSHIKKLRMTKQEIRDEFKDQEGDPHV KGRIRQQQRAMARRRMMADVHKADVIVTNPTHYAVALQYNETKMSAPKVLAKGAGAVALR IRELGAEHRIPLLEAPPLARALFRHSEVGQHIPATLYAAVAEVLAWVYQLKRWKREGGLI PKKPEHLPVPEGLDFATEESETD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Cyclin M4 Antibody, Affinity Purified
MBS3904646-01 0.01 mg

Rabbit anti-Cyclin M4 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-Cyclin M4 Antibody, Affinity Purified
MBS3904646-02 0.1 mg

Rabbit anti-Cyclin M4 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-Cyclin M4 Antibody, Affinity Purified
MBS3904646-03 5x 0.01 mg

Rabbit anti-Cyclin M4 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-Cyclin M4 Antibody, Affinity Purified
MBS3904646-04 5x 0.1 mg

Rabbit anti-Cyclin M4 Antibody, Affinity Purified

Sign In for Pricing
View Details
Human LPPR3 (PLPPR3) (NM_024888) AAV Particle
RC222326A1V 250 µL

Human LPPR3 (PLPPR3) (NM_024888) AAV Particle

Sign In for Pricing
View Details
PE/iFluor® 750 Anti-human CD79b Antibody *CB3-1*
107911T0-AAT 25 Tests

PE/iFluor® 750 Anti-human CD79b Antibody *CB3-1*

Sign In for Pricing
View Details