Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ceramide synthase 6 (CERS6)

This Recombinant Human Ceramide synthase 6 (CERS6) spans the amino acid sequence from region 1-384.

Product Specifications

Product Name Alternative

Ceramide synthase 6, CerS5, LAG1 longevity assurance homolog 6

UniProt

Q6ZMG9

Expression Region

1-384

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGILAWFWNERFWLPHNVTWADLKNTEEATFPQAEDLYLAFPLAFCIFMVRLIFERFVA KPCAIALNIQANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQR RNQEKPSTLTRFCESMWRFSFYLYVFTYGVRFLKKTPWLWNTRHCWYNYPYQPLTTDLHY YYILELSFYWSLMFSQFTDIKRKDFGIMFLHHLVSIFLITFSYVNNMARVGTLVLCLHDS ADALLEAAKMANYAKFQKMCDLLFVMFAVVFITTRLGIFPLWVLNTTLFESWEIVGPYPS WWVFNLLLLLVQGLNCFWSYLIVKIACKAVSRGKVSKDDRSDIESSSDEEDSEPPGKNPH TATTTNGTSGTNGYLLTGSCSMDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Breast
CS507729 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Recombinant Human SIRPB1/CD172b Protein (His Tag)
PKSH033523-01 10 µg

Recombinant Human SIRPB1/CD172b Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human SIRPB1/CD172b Protein (His Tag)
PKSH033523-02 50 µg

Recombinant Human SIRPB1/CD172b Protein (His Tag)

Sign In for Pricing
View Details
Human CSRP3 activation kit by CRISPRa
GA105395 1 Kit

Human CSRP3 activation kit by CRISPRa

Sign In for Pricing
View Details
Rnps1 Mouse Gene Knockout Kit (CRISPR)
KN514972 1 Kit

Rnps1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dipropylene Glycol Diacrylate (~80%)
TRC-D493260-250MG 250 mg

Dipropylene Glycol Diacrylate (~80%)

Sign In for Pricing
View Details