Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Rhomboid domain-containing protein 3 (Rhbdd3)

This Recombinant Mouse Rhomboid domain-containing protein 3 (Rhbdd3) spans the amino acid sequence from region 1-385.

Product Specifications

Product Name Alternative

Rhomboid domain-containing protein 3

UniProt

Q8BP97

Expression Region

1-385

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHAWEAPGSLSRALPLASSVLMLLLSCLWLLGAGPSLRLAPELLMEPWQVHRLLTHALGH TALPGLLLSLLLLPTLGWWQECHLGTVRFLHNSTVLALATGLLAVLLAGLGVSGAAGGCG YMPVHLAMLAGQSHHPGWPQRTLPPWLLPWLLLALTLLLSSEPPFLQLLCGLLTGLAYAA GAFQWLELSEQRLQVLQEGVLCKSLARCWPLRLFPTPGSLGELPVTYPAGVRPATPRPPY LASSDSWPHSDGSAQLPPRLGPGQLTWKNSERGLDWAGSSFASATTMWAALDEQMLQEGI QASLLDVSVQGSQSSLWLPKPSVSSLRLQQLQHMGFPTEQAAVALAATGRVEGAVSLLVE GLVDTEALVTEGRSSPAHCTGTGAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMPD2, ID (AMPD2, AMP deaminase 2, AMP deaminase isoform L)
MBS6004516-01 0.2 mL

AMPD2, ID (AMPD2, AMP deaminase 2, AMP deaminase isoform L)

Sign In for Pricing
View Details
AMPD2, ID (AMPD2, AMP deaminase 2, AMP deaminase isoform L)
MBS6004516-02 5x 0.2 mL

AMPD2, ID (AMPD2, AMP deaminase 2, AMP deaminase isoform L)

Sign In for Pricing
View Details
XFD488 Anti-human CD57 Antibody *HI57a*
10570150-AAT 100 Tests

XFD488 Anti-human CD57 Antibody *HI57a*

Sign In for Pricing
View Details
Mouse Prss16 (NM_019429) AAV Particle
MR218184A1V 250 µL

Mouse Prss16 (NM_019429) AAV Particle

Sign In for Pricing
View Details
PSORS1C2 (NM_014069) Human Recombinant Protein
TP323701M 100 µg

PSORS1C2 (NM_014069) Human Recombinant Protein

Sign In for Pricing
View Details
REMBRANDT® DiGeorge (10p14) syndrome (DGSII) FISH detection assay
C805K.2030.10 10 Assays

REMBRANDT® DiGeorge (10p14) syndrome (DGSII) FISH detection assay

Sign In for Pricing
View Details