Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Rhomboid domain-containing protein 3 (Rhbdd3)

This Recombinant Mouse Rhomboid domain-containing protein 3 (Rhbdd3) spans the amino acid sequence from region 1-385.

Product Specifications

Product Name Alternative

Rhomboid domain-containing protein 3

UniProt

Q8BP97

Expression Region

1-385

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHAWEAPGSLSRALPLASSVLMLLLSCLWLLGAGPSLRLAPELLMEPWQVHRLLTHALGH TALPGLLLSLLLLPTLGWWQECHLGTVRFLHNSTVLALATGLLAVLLAGLGVSGAAGGCG YMPVHLAMLAGQSHHPGWPQRTLPPWLLPWLLLALTLLLSSEPPFLQLLCGLLTGLAYAA GAFQWLELSEQRLQVLQEGVLCKSLARCWPLRLFPTPGSLGELPVTYPAGVRPATPRPPY LASSDSWPHSDGSAQLPPRLGPGQLTWKNSERGLDWAGSSFASATTMWAALDEQMLQEGI QASLLDVSVQGSQSSLWLPKPSVSSLRLQQLQHMGFPTEQAAVALAATGRVEGAVSLLVE GLVDTEALVTEGRSSPAHCTGTGAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA PKcs antibody
20R-2346 50 ug

DNA PKcs antibody

Sign In for Pricing
View Details
GPAT4 Human shRNA Lentiviral Particle (Locus ID 137964)
TL306795V 500 µL Each

GPAT4 Human shRNA Lentiviral Particle (Locus ID 137964)

Sign In for Pricing
View Details
SMTN Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV621131 1.0 µg DNA

SMTN Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Pdgfrl sgRNA CRISPR Lentivector (Rat) (Target 2)
K6690303 1.0 µg DNA

Pdgfrl sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
S6K1 Rabbit Polyclonal Antibody, 1 pack = 50 µL
BAL5429 1 Each

S6K1 Rabbit Polyclonal Antibody, 1 pack = 50 µL

Sign In for Pricing
View Details
Rat Monoclonal CD5 Antibody (53-7.3) [Janelia Fluor 549]
FAB115I 0.5 mL

Rat Monoclonal CD5 Antibody (53-7.3) [Janelia Fluor 549]

Sign In for Pricing
View Details