Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Innexin unc-9 (unc-9)

This Recombinant Innexin unc-9 (unc-9) spans the amino acid sequence from region 1-386.

Product Specifications

Product Name Alternative

Innexin unc-9, Uncoordinated protein 9

UniProt

O01393

Expression Region

1-386

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSMLLYYFASAVKSIQFHVDDDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPAT FTEPMEQYTENYCWVQNTYFLPLHDYIPHNYAERENRQIGYYQWVPFVLALEALLFYVPT IVWRLLSWQSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLK LLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKWYGLQVLNDLMNGR EWEESGHFPRVTLCDFEVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCS LFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAG ELPCYELAKTLWNNYCDNKEGKMHDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Shigella flexneri tdk Polyclonal Antibody
MBS7142323 Inquire

Rabbit anti-Shigella flexneri tdk Polyclonal Antibody

Sign In for Pricing
View Details
beta Arrestin 1 (ARRB1) (NM_004041) Human Recombinant Protein
TP720083XL 1 mg

beta Arrestin 1 (ARRB1) (NM_004041) Human Recombinant Protein

Sign In for Pricing
View Details
RCC2 Double Nickase Plasmid (h)
sc-412640-NIC 20 µg

RCC2 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Bovine MPI ELISA Kit
EF011576 96 Tests

Bovine MPI ELISA Kit

Sign In for Pricing
View Details
Rho-Related GTP-Binding Protein RhoQ (RHOQ) Protein
abx262613-01 2 µg

Rho-Related GTP-Binding Protein RhoQ (RHOQ) Protein

Sign In for Pricing
View Details
Rho-Related GTP-Binding Protein RhoQ (RHOQ) Protein
abx262613-02 10 µg

Rho-Related GTP-Binding Protein RhoQ (RHOQ) Protein

Sign In for Pricing
View Details