Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Innexin unc-9 (unc-9)

This Recombinant Innexin unc-9 (unc-9) spans the amino acid sequence from region 1-386.

Product Specifications

Product Name Alternative

Innexin unc-9, Uncoordinated protein 9

UniProt

O01393

Expression Region

1-386

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSMLLYYFASAVKSIQFHVDDDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPAT FTEPMEQYTENYCWVQNTYFLPLHDYIPHNYAERENRQIGYYQWVPFVLALEALLFYVPT IVWRLLSWQSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLK LLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKWYGLQVLNDLMNGR EWEESGHFPRVTLCDFEVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCS LFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAG ELPCYELAKTLWNNYCDNKEGKMHDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE6A Peptide - N-terminal region (AAP56111)
AAP56111-100UG 100 µg

PDE6A Peptide - N-terminal region (AAP56111)

Sign In for Pricing
View Details
Elongin A CRISPR Activation Plasmid (h)
sc-404668-ACT 20 µg

Elongin A CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Mouse Cytokeratin 17, clone E3 (monoclonal) Antibody
orb1087666 1 mL

Mouse Cytokeratin 17, clone E3 (monoclonal) Antibody

Sign In for Pricing
View Details
Recombinant Campylobacter Jejuni mnmA Protein (aa 1-338)
VAng-Lsx6286-1mgEcoli 1 mg (E. coli)

Recombinant Campylobacter Jejuni mnmA Protein (aa 1-338)

Sign In for Pricing
View Details
FANCM Rabbit Polyclonal Antibody
orb2951017-01 50 µg

FANCM Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FANCM Rabbit Polyclonal Antibody
orb2951017-02 100 µg

FANCM Rabbit Polyclonal Antibody

Sign In for Pricing
View Details